PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010555365.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family CAMTA
Protein Properties Length: 1050aa    MW: 117615 Da    PI: 6.4369
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010555365.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1178.67.8e-56201362118
            CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                     l+ ++rwl++ ei++iL n++++++++e++trp+sgsl+L+nrk +r+frkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+e+n+++qr
  XP_010555365.1  20 LEAQNRWLRPPEICEILRNYQRFQISTEAPTRPPSGSLFLFNRKELRFFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENLQR 114
                     5679******************************************************************************************* PP

            CG-1  97 rcywlLeeelekivlvhylevk 118
                     r+yw+Leeel++iv+vhylevk
  XP_010555365.1 115 RSYWMLEEELSHIVFVHYLEVK 136
                     *******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.55715141IPR005559CG-1 DNA-binding domain
SMARTSM010762.7E-8018136IPR005559CG-1 DNA-binding domain
PfamPF038592.6E-4921135IPR005559CG-1 DNA-binding domain
SuperFamilySSF812965.13E-15477563IPR014756Immunoglobulin E-set
Gene3DG3DSA:1.25.40.205.2E-16576775IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.95E-15659774IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029715.91667745IPR020683Ankyrin repeat-containing domain
CDDcd002041.49E-11669772No hitNo description
PROSITE profilePS5008810.152713745IPR002110Ankyrin repeat
SMARTSM002480.0095713742IPR002110Ankyrin repeat
SuperFamilySSF525405.58E-8871930IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001594879901IPR000048IQ motif, EF-hand binding site
PfamPF006120.081882900IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.657882909IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0011902924IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.468903927IPR000048IQ motif, EF-hand binding site
PfamPF006121.2E-4905924IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1050 aa     Download sequence    Send to blast
MAEARRSSAI NRLDMDQILL EAQNRWLRPP EICEILRNYQ RFQISTEAPT RPPSGSLFLF  60
NRKELRFFRK DGHNWRKKKD GKTVKEAHER LKAGSIDVLH CYYAHGEDNE NLQRRSYWML  120
EEELSHIVFV HYLEVKGSRV STSFNGVQRT EDASRCSPET GDALSNEFDG CASCSINQNY  180
HSMYSQTTDT ASVSGVQTSD YEDAESAYNH HANSKILSQQ DLQPPGTEEA LAGFDPYYQT  240
SLPVRDNYQK GFLAMPGPNS SIMVDKNKEN NCVGLTSGSR KSIDSQTWEE ILGNCGSGFE  300
VLPFQAPYTS VEPTNARDGI SKQEHDILDQ LLHNFTFATQ DFASQQDPME KCQARILNSD  360
FTSVHTSRFH GQDLEAMHNP AANGNAPYSS VITKHLFDGP LDDKGLKKMD SFNRWMSREL  420
GDVDDLASAN DSFTHSRSRT YWDEIETENG ANTPNSRRDL DGYAISPSLS QEQLFSIIDF  480
SPSWTYAGHE VKVLVTGRFL KAQEDFQNFK WSCMFGQFEV PAEVIADGVL RCIAPMHEVA  540
RVPFYITCSN RLACSEVREF EFRVGHAPAM DRGRDDSTHI SIENLQARFV KLLCSKSVCP  600
TSVASTDSDL SHVNKKISSL LVENTNDLDQ MLTVSDSGNV LSSEKMKNQL IEKLLKEKLH  660
SWLLVKVAER GKGPSVLDES GQGVLHFAAA LGYDWALEPT VIAGVSVNFR DVNGWTALHW  720
AAFFGREHTV GSLIALGADP GAVTDPTPVY PSGCSTSDLA YANGHKGIAG YLAESALEAH  780
LSLLSLTDQL GDGGKASPAR TAADSAPGKS SSSMTDSLAA VSKATQAAAR IHQVFRVQSF  840
QRKQMKEFGG NNKFGMSNEH ALSLVTLKAN KAGRYTDDSV YAAATRIQNK FRSYKGRKDY  900
LITRQRIIKI QAHVRGYQVR KNYRKIIWSV GILEKVILRW RRKGSGLRGF KPEALTDRMQ  960
DISENEDDDD DFFKKGRKQT EERLHKALAR VKSMAQYPEA RDQYRRLLNV VNEIQESKIK  1020
ALAISEETSY IDDDDLIDLD ALLDDTPMSF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010555365.10.0PREDICTED: calmodulin-binding transcription activator 3
RefseqXP_010555366.10.0PREDICTED: calmodulin-binding transcription activator 3
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLV4L6Z90.0V4L6Z9_EUTSA; Uncharacterized protein
TrEMBLV4LQS40.0V4LQS4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__153__AT2G22300.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86012535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1